HTRA2 monoclonal antibody (M04), clone 6H8 View larger

HTRA2 monoclonal antibody (M04), clone 6H8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HTRA2 monoclonal antibody (M04), clone 6H8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re

More info about HTRA2 monoclonal antibody (M04), clone 6H8

Brand: Abnova
Reference: H00027429-M04
Product name: HTRA2 monoclonal antibody (M04), clone 6H8
Product description: Mouse monoclonal antibody raised against a partial recombinant HTRA2.
Clone: 6H8
Isotype: IgG1 Kappa
Gene id: 27429
Gene name: HTRA2
Gene alias: OMI|PARK13|PRSS25
Gene description: HtrA serine peptidase 2
Genbank accession: BC000096
Immunogen: HTRA2 (AAH00096, 359 a.a. ~ 458 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQNAEDVYEAVRTQSQLAVQIRRGRETLTLYVTPEVTE
Protein accession: AAH00096
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00027429-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00027429-M04-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to HTRA2 on HeLa cell. [antibody concentration 10 ug/ml]
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy HTRA2 monoclonal antibody (M04), clone 6H8 now

Add to cart