APOBEC3C monoclonal antibody (M01), clone 3E6 View larger

APOBEC3C monoclonal antibody (M01), clone 3E6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of APOBEC3C monoclonal antibody (M01), clone 3E6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,IP

More info about APOBEC3C monoclonal antibody (M01), clone 3E6

Brand: Abnova
Reference: H00027350-M01
Product name: APOBEC3C monoclonal antibody (M01), clone 3E6
Product description: Mouse monoclonal antibody raised against a partial recombinant APOBEC3C.
Clone: 3E6
Isotype: IgG2a Kappa
Gene id: 27350
Gene name: APOBEC3C
Gene alias: APOBEC1L|ARDC2|ARDC4|ARP5|MGC19485|PBI|bK150C2.3
Gene description: apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3C
Genbank accession: NM_014508
Immunogen: APOBEC3C (NP_055323, 91 a.a. ~ 190 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: YTSWSPCPDCAGEVAEFLARHSNVNLTIFTARLYYFQYPCYQEGLRSLSQEGVAVEIMDYEDFKYCWENFVYNDNEPFKPWKGLKTNFRLLKRRLRESLQ
Protein accession: NP_055323
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00027350-M01-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged APOBEC3C is 1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,IP
Shipping condition: Dry Ice

Reviews

Buy APOBEC3C monoclonal antibody (M01), clone 3E6 now

Add to cart