Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MCAT MaxPab rabbit polyclonal antibody (D01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Tr,IP |
More info about MCAT MaxPab rabbit polyclonal antibody (D01)
| Brand: | Abnova |
| Reference: | H00027349-D01 |
| Product name: | MCAT MaxPab rabbit polyclonal antibody (D01) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human MCAT protein. |
| Gene id: | 27349 |
| Gene name: | MCAT |
| Gene alias: | FASN2C|MCT|MGC47838|MT|fabD |
| Gene description: | malonyl CoA:ACP acyltransferase (mitochondrial) |
| Genbank accession: | NM_014507.2 |
| Immunogen: | MCAT (NP_055322.1, 1 a.a. ~ 180 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MSVRVARVAWVRGLGASYRRGASSFPVPPPGAQGVAELLRDATGAEEEAPWAATERRMPGQCSVLLFPGQGSQVVGMGRGLLNYPRVRELYAAARRVLGYDLLELSLHGPQETLDRTVHCQPAIFVASLAAVEKLHHLQPSVIENCVAAAGFSVGEFAALVFAGAMEFAEGSTVSPEEFL |
| Protein accession: | NP_055322.1 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoprecipitation of MCAT transfected lysate using anti-MCAT MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with MCAT MaxPab mouse polyclonal antibody (B01) (H00027349-B01). |
| Applications: | WB-Tr,IP |
| Shipping condition: | Dry Ice |