H00027344-M02_100ug
New product
Availability date:
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00027344-M02 |
Product name: | PCSK1N monoclonal antibody (M02), clone 1E9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PCSK1N. |
Clone: | 1E9 |
Isotype: | IgG2a Kappa |
Gene id: | 27344 |
Gene name: | PCSK1N |
Gene alias: | PROSAAS|SAAS |
Gene description: | proprotein convertase subtilisin/kexin type 1 inhibitor |
Genbank accession: | NM_013271 |
Immunogen: | PCSK1N (NP_037403.1, 173 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DGPAGPDAEEAGDETPDVDPELLRYLLGRILAGSADSEGVAAPRRLRRAADHDVGSELPPEGVLGALLRVKRLETPAPQVPARRLLPP |
Protein accession: | NP_037403.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (35.42 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunoperoxidase of monoclonal antibody to PCSK1N on formalin-fixed paraffin-embedded human cerebellum. [antibody concentration 3 ug/ml] |
Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | Pax6 Directly Down-Regulates Pcsk1n Expression Thereby Regulating PC1/3 Dependent Proinsulin Processing.Liu T, Zhao Y, Tang N, Feng R, Yang X, Lu N, Wen J, Li L. PLoS One. 2012;7(10):e46934. doi: 10.1371/journal.pone.0046934. Epub 2012 Oct 9. |