PCSK1N monoclonal antibody (M02), clone 1E9 View larger

PCSK1N monoclonal antibody (M02), clone 1E9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PCSK1N monoclonal antibody (M02), clone 1E9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about PCSK1N monoclonal antibody (M02), clone 1E9

Brand: Abnova
Reference: H00027344-M02
Product name: PCSK1N monoclonal antibody (M02), clone 1E9
Product description: Mouse monoclonal antibody raised against a partial recombinant PCSK1N.
Clone: 1E9
Isotype: IgG2a Kappa
Gene id: 27344
Gene name: PCSK1N
Gene alias: PROSAAS|SAAS
Gene description: proprotein convertase subtilisin/kexin type 1 inhibitor
Genbank accession: NM_013271
Immunogen: PCSK1N (NP_037403.1, 173 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DGPAGPDAEEAGDETPDVDPELLRYLLGRILAGSADSEGVAAPRRLRRAADHDVGSELPPEGVLGALLRVKRLETPAPQVPARRLLPP
Protein accession: NP_037403.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00027344-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.42 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00027344-M02-3-52-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to PCSK1N on formalin-fixed paraffin-embedded human cerebellum. [antibody concentration 3 ug/ml]
Applications: IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice
Publications: Pax6 Directly Down-Regulates Pcsk1n Expression Thereby Regulating PC1/3 Dependent Proinsulin Processing.Liu T, Zhao Y, Tang N, Feng R, Yang X, Lu N, Wen J, Li L.
PLoS One. 2012;7(10):e46934. doi: 10.1371/journal.pone.0046934. Epub 2012 Oct 9.

Reviews

Buy PCSK1N monoclonal antibody (M02), clone 1E9 now

Add to cart