PCSK1N purified MaxPab mouse polyclonal antibody (B01P) View larger

PCSK1N purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PCSK1N purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about PCSK1N purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00027344-B01P
Product name: PCSK1N purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human PCSK1N protein.
Gene id: 27344
Gene name: PCSK1N
Gene alias: PROSAAS|SAAS
Gene description: proprotein convertase subtilisin/kexin type 1 inhibitor
Genbank accession: NM_013271
Immunogen: PCSK1N (NP_037403.1, 1 a.a. ~ 260 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAGSPLLWGPRAGGVGLLVLLLLGLFRPPPALCARPVKEPRGLSAASPPLAETGAPRRFRRSVPRGEAAGAVQELARALAHLLEAERQERARAEAQEAEDQQARVLAQLLRVWGAPRNSDPALGLDDDPDAPAAQLARALLRARLDPAALAAQLVPAPVPAAALRPRPPVYDDGPAGPDAEEAGDETPDVDPELLRYLLGRILAGSADSEGVAAPRRLRRAADHDVGSELPPEGVLGALLRVKRLETPAPQVPARRLLPP
Protein accession: NP_037403.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: H00027344-B01P-13-15-1.jpg
Application image note: Western Blot analysis of PCSK1N expression in transfected 293T cell line (H00027344-T02) by PCSK1N MaxPab polyclonal antibody.

Lane 1: PCSK1N transfected lysate(28.6 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PCSK1N purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart