Brand: | Abnova |
Reference: | H00027339-M07 |
Product name: | PRPF19 monoclonal antibody (M07), clone 2E5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PRPF19. |
Clone: | 2E5 |
Isotype: | IgG2a Kappa |
Gene id: | 27339 |
Gene name: | PRPF19 |
Gene alias: | NMP200|PRP19|PSO4|SNEV|UBOX4|hPSO4 |
Gene description: | PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae) |
Genbank accession: | NM_014502 |
Immunogen: | PRPF19 (NP_055317, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSLICSISNEVPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVAHPIRPKPPSATSIPAILKALQDEWDAVMLHSF |
Protein accession: | NP_055317 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: |  |
Application image note: | PRPF19 monoclonal antibody (M07), clone 2E5. Western Blot analysis of PRPF19 expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |