PRPF19 monoclonal antibody (M07), clone 2E5 View larger

PRPF19 monoclonal antibody (M07), clone 2E5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PRPF19 monoclonal antibody (M07), clone 2E5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about PRPF19 monoclonal antibody (M07), clone 2E5

Brand: Abnova
Reference: H00027339-M07
Product name: PRPF19 monoclonal antibody (M07), clone 2E5
Product description: Mouse monoclonal antibody raised against a partial recombinant PRPF19.
Clone: 2E5
Isotype: IgG2a Kappa
Gene id: 27339
Gene name: PRPF19
Gene alias: NMP200|PRP19|PSO4|SNEV|UBOX4|hPSO4
Gene description: PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae)
Genbank accession: NM_014502
Immunogen: PRPF19 (NP_055317, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSLICSISNEVPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVAHPIRPKPPSATSIPAILKALQDEWDAVMLHSF
Protein accession: NP_055317
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00027339-M07-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.64 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: H00027339-M07-1-25-1.jpg
Application image note: PRPF19 monoclonal antibody (M07), clone 2E5. Western Blot analysis of PRPF19 expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PRPF19 monoclonal antibody (M07), clone 2E5 now

Add to cart