UBE2S purified MaxPab mouse polyclonal antibody (B01P) View larger

UBE2S purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of UBE2S purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,WB-Tr

More info about UBE2S purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00027338-B01P
Product name: UBE2S purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human UBE2S protein.
Gene id: 27338
Gene name: UBE2S
Gene alias: E2-EPF|E2EPF|EPF5
Gene description: ubiquitin-conjugating enzyme E2S
Genbank accession: NM_014501.2
Immunogen: UBE2S (NP_055316.2, 1 a.a. ~ 222 a.a) full-length human protein.
Immunogen sequence/protein sequence: MNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYAGGLFRMKLLLGKDFPASPPKGYFLTKIFHPNVGANGEICVNVLKRDWTAELGIRHVLLTIKCLLIHPNPESALNEEAGRLLLENYEEYAARARLLTEIHGGAGGPSGRAEAGRALASGTEASSTDPGAPGGPGGAEGPMAKKHAGERDKKLAAKKKTDKKRALRRL
Protein accession: NP_055316.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00027338-B01P-13-15-1.jpg
Application image note: Western Blot analysis of UBE2S expression in transfected 293T cell line (H00027338-T01) by UBE2S MaxPab polyclonal antibody.

Lane 1: UBE2S transfected lysate(24.42 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy UBE2S purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart