GOLPH4 monoclonal antibody (M01), clone 5E11 View larger

GOLPH4 monoclonal antibody (M01), clone 5E11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GOLPH4 monoclonal antibody (M01), clone 5E11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re

More info about GOLPH4 monoclonal antibody (M01), clone 5E11

Brand: Abnova
Reference: H00027333-M01
Product name: GOLPH4 monoclonal antibody (M01), clone 5E11
Product description: Mouse monoclonal antibody raised against a partial recombinant GOLPH4.
Clone: 5E11
Isotype: IgG2a Kappa
Gene id: 27333
Gene name: GOLIM4
Gene alias: GIMPC|GOLPH4|GPP130|P138
Gene description: golgi integral membrane protein 4
Genbank accession: NM_014498
Immunogen: GOLPH4 (NP_055311.1, 473 a.a. ~ 568 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: HQEQLRQQAHYDAMDNDIVQGAEDQGIQGEEGAYERDNQHQDEAEGDPGNRHEPREQGPREADPESEADRAAVEDINPADDPNNQGEDEFEEAEQV
Protein accession: NP_055311.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00027333-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.3 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00027333-M01-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to GOLPH4 on HeLa cell. [antibody concentration 10 ug/ml]
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy GOLPH4 monoclonal antibody (M01), clone 5E11 now

Add to cart