No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00027333-M01 |
Product name: | GOLPH4 monoclonal antibody (M01), clone 5E11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant GOLPH4. |
Clone: | 5E11 |
Isotype: | IgG2a Kappa |
Gene id: | 27333 |
Gene name: | GOLIM4 |
Gene alias: | GIMPC|GOLPH4|GPP130|P138 |
Gene description: | golgi integral membrane protein 4 |
Genbank accession: | NM_014498 |
Immunogen: | GOLPH4 (NP_055311.1, 473 a.a. ~ 568 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | HQEQLRQQAHYDAMDNDIVQGAEDQGIQGEEGAYERDNQHQDEAEGDPGNRHEPREQGPREADPESEADRAAVEDINPADDPNNQGEDEFEEAEQV |
Protein accession: | NP_055311.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.3 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunofluorescence of monoclonal antibody to GOLPH4 on HeLa cell. [antibody concentration 10 ug/ml] |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |