RPS6KA6 monoclonal antibody (M03), clone 8H5 View larger

RPS6KA6 monoclonal antibody (M03), clone 8H5

H00027330-M03_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RPS6KA6 monoclonal antibody (M03), clone 8H5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesMouse
ApplicationsWB-Ce,IHC-P,ELISA,WB-Re

More info about RPS6KA6 monoclonal antibody (M03), clone 8H5

Brand: Abnova
Reference: H00027330-M03
Product name: RPS6KA6 monoclonal antibody (M03), clone 8H5
Product description: Mouse monoclonal antibody raised against a partial recombinant RPS6KA6.
Clone: 8H5
Isotype: IgG2a Kappa
Gene id: 27330
Gene name: RPS6KA6
Gene alias: RSK4
Gene description: ribosomal protein S6 kinase, 90kDa, polypeptide 6
Genbank accession: NM_014496
Immunogen: RPS6KA6 (NP_055311.1, 636 a.a. ~ 745 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RIGNGKFSLSGGNWDNISDGAKDLLSHMLHMDPHQRYTAEQILKHSWITHRDQLPNDQPKRNDVSHVVKGAMVATYSALTHKTFQPVLEPVAASSLAQRRSMKKRTSTGL
Protein accession: NP_055311.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00027330-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: H00027330-M03-3-5-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to RPS6KA6 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]
Applications: WB-Ce,IHC-P,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RPS6KA6 monoclonal antibody (M03), clone 8H5 now

Add to cart