H00027330-M03_100ug
New product
Availability date:
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Rat |
Host species | Mouse |
Applications | WB-Ce,IHC-P,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00027330-M03 |
Product name: | RPS6KA6 monoclonal antibody (M03), clone 8H5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RPS6KA6. |
Clone: | 8H5 |
Isotype: | IgG2a Kappa |
Gene id: | 27330 |
Gene name: | RPS6KA6 |
Gene alias: | RSK4 |
Gene description: | ribosomal protein S6 kinase, 90kDa, polypeptide 6 |
Genbank accession: | NM_014496 |
Immunogen: | RPS6KA6 (NP_055311.1, 636 a.a. ~ 745 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RIGNGKFSLSGGNWDNISDGAKDLLSHMLHMDPHQRYTAEQILKHSWITHRDQLPNDQPKRNDVSHVVKGAMVATYSALTHKTFQPVLEPVAASSLAQRRSMKKRTSTGL |
Protein accession: | NP_055311.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: | ![]() |
Application image note: | Immunoperoxidase of monoclonal antibody to RPS6KA6 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,IHC-P,ELISA,WB-Re |
Shipping condition: | Dry Ice |