Brand: | Abnova |
Reference: | H00027329-M10 |
Product name: | ANGPTL3 monoclonal antibody (M10), clone 3F11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ANGPTL3. |
Clone: | 3F11 |
Isotype: | IgG2a Kappa |
Gene id: | 27329 |
Gene name: | ANGPTL3 |
Gene alias: | ANGPT5 |
Gene description: | angiopoietin-like 3 |
Genbank accession: | NM_014495 |
Immunogen: | ANGPTL3 (NP_055310.1, 361 a.a. ~ 460 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | HLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFE |
Protein accession: | NP_055310.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged ANGPTL3 is 0.3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,IP |
Shipping condition: | Dry Ice |