ANGPTL3 monoclonal antibody (M10), clone 3F11 View larger

ANGPTL3 monoclonal antibody (M10), clone 3F11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ANGPTL3 monoclonal antibody (M10), clone 3F11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,IP

More info about ANGPTL3 monoclonal antibody (M10), clone 3F11

Brand: Abnova
Reference: H00027329-M10
Product name: ANGPTL3 monoclonal antibody (M10), clone 3F11
Product description: Mouse monoclonal antibody raised against a partial recombinant ANGPTL3.
Clone: 3F11
Isotype: IgG2a Kappa
Gene id: 27329
Gene name: ANGPTL3
Gene alias: ANGPT5
Gene description: angiopoietin-like 3
Genbank accession: NM_014495
Immunogen: ANGPTL3 (NP_055310.1, 361 a.a. ~ 460 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: HLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFE
Protein accession: NP_055310.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00027329-M10-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00027329-M10-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged ANGPTL3 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,IP
Shipping condition: Dry Ice

Reviews

Buy ANGPTL3 monoclonal antibody (M10), clone 3F11 now

Add to cart