ANGPTL3 monoclonal antibody (M01), clone 3B7 View larger

ANGPTL3 monoclonal antibody (M01), clone 3B7

H00027329-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ANGPTL3 monoclonal antibody (M01), clone 3B7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,S-ELISA,ELISA,WB-Re,WB-Tr

More info about ANGPTL3 monoclonal antibody (M01), clone 3B7

Brand: Abnova
Reference: H00027329-M01
Product name: ANGPTL3 monoclonal antibody (M01), clone 3B7
Product description: Mouse monoclonal antibody raised against a full-length recombinant ANGPTL3.
Clone: 3B7
Isotype: IgG2a Kappa
Gene id: 27329
Gene name: ANGPTL3
Gene alias: ANGPT5
Gene description: angiopoietin-like 3
Genbank accession: BC058287
Immunogen: ANGPTL3 (AAH58287, 17 a.a. ~ 460 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISGSPWTLIQHRIDGSQNFNETWENYKYGFGRLDGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYIEYSFYLGNHETNYTLHLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFE
Protein accession: AAH58287
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00027329-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (74.58 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00027329-M01-3-12-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to ANGPTL3 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]
Applications: IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ANGPTL3 monoclonal antibody (M01), clone 3B7 now

Add to cart