Brand: | Abnova |
Reference: | H00027328-M05 |
Product name: | PCDH11X monoclonal antibody (M05), clone 7B4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PCDH11X. |
Clone: | 7B4 |
Isotype: | IgG2a Kappa |
Gene id: | 27328 |
Gene name: | PCDH11X |
Gene alias: | PCDH-X|PCDH11|PCDHX|PCDHY |
Gene description: | protocadherin 11 X-linked |
Genbank accession: | NM_032969 |
Immunogen: | PCDH11X (NP_061850, 1228 a.a. ~ 1336 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | AQASALCYSPPLAQAAAISHSSPLPQVIALHRSQAQSSVSLQQGWVQGADGLCSVDQGVQGSATSQFYTMSERLHPSDDSIKVIPLTTFTPRQQARPSRGDSPIMEEHP |
Protein accession: | NP_061850 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | PCDH11X monoclonal antibody (M05), clone 7B4. Western Blot analysis of PCDH11X expression in A-431. |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |