PCDH11X monoclonal antibody (M05), clone 7B4 View larger

PCDH11X monoclonal antibody (M05), clone 7B4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PCDH11X monoclonal antibody (M05), clone 7B4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about PCDH11X monoclonal antibody (M05), clone 7B4

Brand: Abnova
Reference: H00027328-M05
Product name: PCDH11X monoclonal antibody (M05), clone 7B4
Product description: Mouse monoclonal antibody raised against a partial recombinant PCDH11X.
Clone: 7B4
Isotype: IgG2a Kappa
Gene id: 27328
Gene name: PCDH11X
Gene alias: PCDH-X|PCDH11|PCDHX|PCDHY
Gene description: protocadherin 11 X-linked
Genbank accession: NM_032969
Immunogen: PCDH11X (NP_061850, 1228 a.a. ~ 1336 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: AQASALCYSPPLAQAAAISHSSPLPQVIALHRSQAQSSVSLQQGWVQGADGLCSVDQGVQGSATSQFYTMSERLHPSDDSIKVIPLTTFTPRQQARPSRGDSPIMEEHP
Protein accession: NP_061850
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00027328-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00027328-M05-1-4-1.jpg
Application image note: PCDH11X monoclonal antibody (M05), clone 7B4. Western Blot analysis of PCDH11X expression in A-431.
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PCDH11X monoclonal antibody (M05), clone 7B4 now

Add to cart