TNRC6A monoclonal antibody (M11), clone 2E7 View larger

TNRC6A monoclonal antibody (M11), clone 2E7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TNRC6A monoclonal antibody (M11), clone 2E7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA,WB-Re

More info about TNRC6A monoclonal antibody (M11), clone 2E7

Brand: Abnova
Reference: H00027327-M11
Product name: TNRC6A monoclonal antibody (M11), clone 2E7
Product description: Mouse monoclonal antibody raised against a partial recombinant TNRC6A.
Clone: 2E7
Isotype: IgG2a Kappa
Gene id: 27327
Gene name: TNRC6A
Gene alias: CAGH26|DKFZp666E117|FLJ22043|GW1|GW182|KIAA1460|MGC75384|TNRC6
Gene description: trinucleotide repeat containing 6A
Genbank accession: NM_014494
Immunogen: TNRC6A (NP_055309, 454 a.a. ~ 553 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: NNTTNFMTSSLPNSGSVQNNELPSSNTGAWRVSTMNHPQMQAPSGMNGTSLSHLSNGESKSGGSYGTTWGAYGSNYSGDKCSGPNGQANGDTVNATLMQP
Protein accession: NP_055309
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00027327-M11-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.00 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00027327-M11-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to TNRC6A on HeLa cell . [antibody concentration 10 ug/ml]
Applications: IF,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TNRC6A monoclonal antibody (M11), clone 2E7 now

Add to cart