Brand: | Abnova |
Reference: | H00027327-M11 |
Product name: | TNRC6A monoclonal antibody (M11), clone 2E7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TNRC6A. |
Clone: | 2E7 |
Isotype: | IgG2a Kappa |
Gene id: | 27327 |
Gene name: | TNRC6A |
Gene alias: | CAGH26|DKFZp666E117|FLJ22043|GW1|GW182|KIAA1460|MGC75384|TNRC6 |
Gene description: | trinucleotide repeat containing 6A |
Genbank accession: | NM_014494 |
Immunogen: | TNRC6A (NP_055309, 454 a.a. ~ 553 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | NNTTNFMTSSLPNSGSVQNNELPSSNTGAWRVSTMNHPQMQAPSGMNGTSLSHLSNGESKSGGSYGTTWGAYGSNYSGDKCSGPNGQANGDTVNATLMQP |
Protein accession: | NP_055309 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.00 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to TNRC6A on HeLa cell . [antibody concentration 10 ug/ml] |
Applications: | IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |