RBMS3 monoclonal antibody (M02), clone 3B11 View larger

RBMS3 monoclonal antibody (M02), clone 3B11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RBMS3 monoclonal antibody (M02), clone 3B11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about RBMS3 monoclonal antibody (M02), clone 3B11

Brand: Abnova
Reference: H00027303-M02
Product name: RBMS3 monoclonal antibody (M02), clone 3B11
Product description: Mouse monoclonal antibody raised against a partial recombinant RBMS3.
Clone: 3B11
Isotype: IgG2a Kappa
Gene id: 27303
Gene name: RBMS3
Gene alias: -
Gene description: RNA binding motif, single stranded interacting protein
Genbank accession: NM_014483.3
Immunogen: RBMS3 (NP_055298.2, 311 a.a. ~ 420 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QPTGAVITPTMDHPMSMQPANMMGPLTQQMNHLSLGTTGTYMTAAAPMQGTYIPQYTPVPPTAVSIEGVVADTSPQTVAPSSQDTSGQQQQIAVDTSNEHAPAYSYQQSK
Protein accession: NP_055298
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00027303-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.21 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RBMS3 monoclonal antibody (M02), clone 3B11 now

Add to cart