ADAMDEC1 monoclonal antibody (M03), clone 1G2 View larger

ADAMDEC1 monoclonal antibody (M03), clone 1G2

H00027299-M03_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ADAMDEC1 monoclonal antibody (M03), clone 1G2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about ADAMDEC1 monoclonal antibody (M03), clone 1G2

Brand: Abnova
Reference: H00027299-M03
Product name: ADAMDEC1 monoclonal antibody (M03), clone 1G2
Product description: Mouse monoclonal antibody raised against a partial recombinant ADAMDEC1.
Clone: 1G2
Isotype: IgG2a Kappa
Gene id: 27299
Gene name: ADAMDEC1
Gene alias: M12.219
Gene description: ADAM-like, decysin 1
Genbank accession: NM_014479
Immunogen: ADAMDEC1 (NP_055294, 361 a.a. ~ 470 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCLLQAPIPTNIMTTPVCGNHLLEVGEDCDCGSPKECTNLCCEALTCKLKPGTDCGGDAPNHTTE
Protein accession: NP_055294
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00027299-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00027299-M03-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged ADAMDEC1 is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ADAMDEC1 monoclonal antibody (M03), clone 1G2 now

Add to cart