ADAMDEC1 monoclonal antibody (M01), clone 6C4 View larger

ADAMDEC1 monoclonal antibody (M01), clone 6C4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ADAMDEC1 monoclonal antibody (M01), clone 6C4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,S-ELISA,ELISA,WB-Re

More info about ADAMDEC1 monoclonal antibody (M01), clone 6C4

Brand: Abnova
Reference: H00027299-M01
Product name: ADAMDEC1 monoclonal antibody (M01), clone 6C4
Product description: Mouse monoclonal antibody raised against a partial recombinant ADAMDEC1.
Clone: 6C4
Isotype: IgG2a Kappa
Gene id: 27299
Gene name: ADAMDEC1
Gene alias: M12.219
Gene description: ADAM-like, decysin 1
Genbank accession: NM_014479
Immunogen: ADAMDEC1 (NP_055294, 361 a.a. ~ 470 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCLLQAPIPTNIMTTPVCGNHLLEVGEDCDCGSPKECTNLCCEALTCKLKPGTDCGGDAPNHTTE
Protein accession: NP_055294
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00027299-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00027299-M01-3-5-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to ADAMDEC1 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]
Applications: IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Gene Expression Profiling Identifies MMP-12 and ADAMDEC1 as Potential Pathogenic Mediators of Pulmonary Sarcoidosis.Crouser ED, Culver DA, Knox KS, Julian MW, Shao G, Abraham S, Liyanarachchi S, Macre JE, Wewers MD, Gavrilin MA, Ross P, Abbas A, Eng C.
Am J Respir Crit Care Med. 2009 May 15;179(10):929-38. Epub 2009 Feb 12.

Reviews

Buy ADAMDEC1 monoclonal antibody (M01), clone 6C4 now

Add to cart