Brand: | Abnova |
Reference: | H00027297-A01 |
Product name: | RCP9 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant RCP9. |
Gene id: | 27297 |
Gene name: | CRCP |
Gene alias: | CGRP-RCP|MGC111194|RCP|RCP9 |
Gene description: | CGRP receptor component |
Genbank accession: | NM_014478 |
Immunogen: | RCP9 (NP_055293, 39 a.a. ~ 148 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | QQNLNTITYETLKYISKTPCRHQSPEIVREFLTALKSHKLTKAEKLQLLNHRPVTAVEIQLMVEESEERLTEEQIEALLHTVTSILPAEPEAEQKKNTNSNVAMDEEDPA |
Protein accession: | NP_055293 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | RCP9 polyclonal antibody (A01), Lot # 051018JC01 Western Blot analysis of RCP9 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |