C20orf10 monoclonal antibody (M01), clone 3C2 View larger

C20orf10 monoclonal antibody (M01), clone 3C2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of C20orf10 monoclonal antibody (M01), clone 3C2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about C20orf10 monoclonal antibody (M01), clone 3C2

Brand: Abnova
Reference: H00027296-M01
Product name: C20orf10 monoclonal antibody (M01), clone 3C2
Product description: Mouse monoclonal antibody raised against a partial recombinant C20orf10.
Clone: 3C2
Isotype: IgG2a Kappa
Gene id: 27296
Gene name: TP53TG5
Gene alias: C20orf10|CLG01
Gene description: TP53 target 5
Genbank accession: BC036785
Immunogen: C20orf10 (AAH36785, 191 a.a. ~ 290 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RNRTPMGHMKQLDVADQWIWFEGLPTRIHLPAPRVMCRSSTLRWVKRRCTRFCSASLEMPMWHPYKVDVTWTRARGASRGWRSRHQLKGRNGWRNSRVYK
Protein accession: AAH36785
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00027296-M01-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged TP53TG5 is 1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy C20orf10 monoclonal antibody (M01), clone 3C2 now

Add to cart