Brand: | Abnova |
Reference: | H00027296-M01 |
Product name: | C20orf10 monoclonal antibody (M01), clone 3C2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant C20orf10. |
Clone: | 3C2 |
Isotype: | IgG2a Kappa |
Gene id: | 27296 |
Gene name: | TP53TG5 |
Gene alias: | C20orf10|CLG01 |
Gene description: | TP53 target 5 |
Genbank accession: | BC036785 |
Immunogen: | C20orf10 (AAH36785, 191 a.a. ~ 290 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RNRTPMGHMKQLDVADQWIWFEGLPTRIHLPAPRVMCRSSTLRWVKRRCTRFCSASLEMPMWHPYKVDVTWTRARGASRGWRSRHQLKGRNGWRNSRVYK |
Protein accession: | AAH36785 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged TP53TG5 is 1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |