DHDH monoclonal antibody (M03), clone 3A11 View larger

DHDH monoclonal antibody (M03), clone 3A11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DHDH monoclonal antibody (M03), clone 3A11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about DHDH monoclonal antibody (M03), clone 3A11

Brand: Abnova
Reference: H00027294-M03
Product name: DHDH monoclonal antibody (M03), clone 3A11
Product description: Mouse monoclonal antibody raised against a partial recombinant DHDH.
Clone: 3A11
Isotype: IgG2a Kappa
Gene id: 27294
Gene name: DHDH
Gene alias: HUM2DD
Gene description: dihydrodiol dehydrogenase (dimeric)
Genbank accession: NM_014475
Immunogen: DHDH (NP_055290, 235 a.a. ~ 334 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SNTASVSGTKGMAQLLNPCWCPTELVVKGEHKEFPLPPVPKDCNFDNGAGMSYEAKHVWECLRKGMKESPVIPLSESELLADILEEVRKAIGVTFPQDKR
Protein accession: NP_055290
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00027294-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00027294-M03-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged DHDH is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy DHDH monoclonal antibody (M03), clone 3A11 now

Add to cart