Brand: | Abnova |
Reference: | H00027285-M02 |
Product name: | TEKT2 monoclonal antibody (M02), clone 2H4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TEKT2. |
Clone: | 2H4 |
Isotype: | IgG2a Kappa |
Gene id: | 27285 |
Gene name: | TEKT2 |
Gene alias: | TEKTB1|TEKTIN-T|h-tektin-t |
Gene description: | tektin 2 (testicular) |
Genbank accession: | NM_014466 |
Immunogen: | TEKT2 (NP_055281, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MATLSVKPSRRFQLPDWHTNSYLLSTNAQLQRDASHQIRQEARVLRNETNNQTIWDEHDNRTRLVERIDTVNRWKEMLDKCLTDLDAEIDALTQMKESA |
Protein accession: | NP_055281 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | TEKT2 monoclonal antibody (M02), clone 2H4. Western Blot analysis of TEKT2 expression in HeLa. |
Applications: | WB-Ce,WB-Ti,ELISA,WB-Re |
Shipping condition: | Dry Ice |