TEKT2 monoclonal antibody (M02), clone 2H4 View larger

TEKT2 monoclonal antibody (M02), clone 2H4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TEKT2 monoclonal antibody (M02), clone 2H4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,WB-Ti,ELISA,WB-Re

More info about TEKT2 monoclonal antibody (M02), clone 2H4

Brand: Abnova
Reference: H00027285-M02
Product name: TEKT2 monoclonal antibody (M02), clone 2H4
Product description: Mouse monoclonal antibody raised against a partial recombinant TEKT2.
Clone: 2H4
Isotype: IgG2a Kappa
Gene id: 27285
Gene name: TEKT2
Gene alias: TEKTB1|TEKTIN-T|h-tektin-t
Gene description: tektin 2 (testicular)
Genbank accession: NM_014466
Immunogen: TEKT2 (NP_055281, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MATLSVKPSRRFQLPDWHTNSYLLSTNAQLQRDASHQIRQEARVLRNETNNQTIWDEHDNRTRLVERIDTVNRWKEMLDKCLTDLDAEIDALTQMKESA
Protein accession: NP_055281
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00027285-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00027285-M02-1-1-1.jpg
Application image note: TEKT2 monoclonal antibody (M02), clone 2H4. Western Blot analysis of TEKT2 expression in HeLa.
Applications: WB-Ce,WB-Ti,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TEKT2 monoclonal antibody (M02), clone 2H4 now

Add to cart