SULT1B1 purified MaxPab mouse polyclonal antibody (B02P) View larger

SULT1B1 purified MaxPab mouse polyclonal antibody (B02P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SULT1B1 purified MaxPab mouse polyclonal antibody (B02P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about SULT1B1 purified MaxPab mouse polyclonal antibody (B02P)

Brand: Abnova
Reference: H00027284-B02P
Product name: SULT1B1 purified MaxPab mouse polyclonal antibody (B02P)
Product description: Mouse polyclonal antibody raised against a full-length human SULT1B1 protein.
Gene id: 27284
Gene name: SULT1B1
Gene alias: MGC13356|ST1B2|SULT1B2
Gene description: sulfotransferase family, cytosolic, 1B, member 1
Genbank accession: NM_014465.2
Immunogen: SULT1B1 (NP_055280.2, 1 a.a. ~ 296 a.a) full-length human protein.
Immunogen sequence/protein sequence: MLSPKDILRKDLKLVHGYPMTCAFASNWEKIEQFHSRPDDIVIATYPKSGTTWVSEIIDMILNDGDIEKCKRGFITEKVPMLEMTLPGLRTSGIEQLEKNPSPRIVKTHLPTDLLPKSFWENNCKMIYLARNAKDVSVSYYHFDLMNNLQPFPGTWEEYLEKFLTGKVAYGSWFTHVKNWWKKKEEHPILFLYYEDMKENPKEEIKKIIRFLEKNLNDEILDRIIHHTSFEVMKDNPLVNYTHLPTTVMDHSKSPFMRKGTAGDWKNYFTVAQNEKFDAIYETEMSKTALQFRTEI
Protein accession: NP_055280.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00027284-B02P-13-15-1.jpg
Application image note: Western Blot analysis of SULT1B1 expression in transfected 293T cell line (H00027284-T02) by SULT1B1 MaxPab polyclonal antibody.

Lane 1: SULT1B1 transfected lysate(32.56 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SULT1B1 purified MaxPab mouse polyclonal antibody (B02P) now

Add to cart