ZNF364 MaxPab mouse polyclonal antibody (B01) View larger

ZNF364 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF364 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about ZNF364 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00027246-B01
Product name: ZNF364 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human ZNF364 protein.
Gene id: 27246
Gene name: RNF115
Gene alias: BCA2|ZNF364
Gene description: ring finger protein 115
Genbank accession: NM_014455
Immunogen: ZNF364 (NP_055270, 1 a.a. ~ 304 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAEASAAGADSGAAVAAHRFFCHFCKGEVSPKLPEYICPRCESGFIEEVTDDSSFLGGGGSRIDNTTTTHFAELWGHLDHTMFFQDFRPFLSSSPLDQDNRANERGHQTHTDFWGARPPRLPLGRRYRSRGSSRPDRSPAIEGILQHIFAGFFANSAIPGSPHPFSWSGMLHSNPGDYAWGQTGLDAIVTQLLGQLENTGPPPADKEKITSLPTVTVTQEQVDMGLECPVCKEDYTVEEEVRQLPCNHFFHSSCIVPWLELHDTCPVCRKSLNGEDSTRQSQSTEASASNRFSNDSQLHDRWTF
Protein accession: NP_055270
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00027246-B01-13-15-1.jpg
Application image note: Western Blot analysis of RNF115 expression in transfected 293T cell line (H00027246-T01) by RNF115 MaxPab polyclonal antibody.

Lane 1: ZNF364 transfected lysate(33.44 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ZNF364 MaxPab mouse polyclonal antibody (B01) now

Add to cart