Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00027241-D02P |
Product name: | BBS9 purified MaxPab rabbit polyclonal antibody (D02P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human BBS9 protein. |
Gene id: | 27241 |
Gene name: | BBS9 |
Gene alias: | B1|C18|D1|MGC118917|PTHB1 |
Gene description: | Bardet-Biedl syndrome 9 |
Genbank accession: | BC032715.1 |
Immunogen: | BBS9 (AAH32715.1, 1 a.a. ~ 310 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MGYLRIFSPHPAKTGDGAQAEDLLLEVDLRDPVLQVEVGKFVSGTEMLHLAVLHSRKLCVYSVSGTLGNVEHGNQCQMKLMYEHNLQRTACNMTYGSFGGVKGRDLICIQSMDGMLMVFEQESYAFGRFLPGFLLPGPLAYSSRTDSFLTVSSCQQVESYKYQVLAFATDADKRQETEQQKLGSGKRLVVDWTLNIGEQALDICIVSFNQSASSVFVLGERNFFCLKDNGQIRFMKKLDWSPSCFLPYCSVSEGTINTLIGNHNNMLHIYQDVTLKWATQLPHIPVAVRVGCLQFSLWKHLLPRSSTLEK |
Protein accession: | AAH32715.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of BBS9 expression in transfected 293T cell line (H00027241-T02) by BBS9 MaxPab polyclonal antibody. Lane 1: BBS9 transfected lysate(34.80 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |