SULT1C2 monoclonal antibody (M01), clone 4D9 View larger

SULT1C2 monoclonal antibody (M01), clone 4D9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SULT1C2 monoclonal antibody (M01), clone 4D9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about SULT1C2 monoclonal antibody (M01), clone 4D9

Brand: Abnova
Reference: H00027233-M01
Product name: SULT1C2 monoclonal antibody (M01), clone 4D9
Product description: Mouse monoclonal antibody raised against a partial recombinant SULT1C2.
Clone: 4D9
Isotype: IgG2b Kappa
Gene id: 27233
Gene name: SULT1C4
Gene alias: MGC149521|MGC34422|SULT1C|SULT1C2
Gene description: sulfotransferase family, cytosolic, 1C, member 4
Genbank accession: BC058861
Immunogen: SULT1C2 (AAH58861.1, 1 a.a. ~ 102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MALHDMEDFTFDGTKRLSVNYVKGILQPTDTCDIWDKIWNFQAKPDDLLISTYPKAGTTWTQEIVELIQNEGDVEKSKRAPTHQRFPFLEMKIPSLGSGEYK
Protein accession: AAH58861.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00027233-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.96 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00027233-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged SULT1C4 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SULT1C2 monoclonal antibody (M01), clone 4D9 now

Add to cart