Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of GNMT MaxPab rabbit polyclonal antibody (D01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Tr,IP |
More info about GNMT MaxPab rabbit polyclonal antibody (D01)
| Brand: | Abnova |
| Reference: | H00027232-D01 |
| Product name: | GNMT MaxPab rabbit polyclonal antibody (D01) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human GNMT protein. |
| Gene id: | 27232 |
| Gene name: | GNMT |
| Gene alias: | - |
| Gene description: | glycine N-methyltransferase |
| Genbank accession: | NM_018960 |
| Immunogen: | GNMT (NP_061833.1, 1 a.a. ~ 295 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MVDSVYRTRSLGVAAEGLPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCQRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRHEPAFDKWVIEEANWMTLDKDVPQSAEGGFDAVICLGNSFAHLPDCKGDQSEHRLALKNIASMVRAGGLLVIDHRNYDHILSTGCAPPGKNIYYKSDLTKDVTTSVLIVNNKAHMVTLDYTVQVPGAGQDGSPGLSKFRLSYYPHCLASFTELLQAAFGGKCQHSVLGDFKPYKPGQTYIPCYFIHVLKRTD |
| Protein accession: | NP_061833.1 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoprecipitation of GNMT transfected lysate using anti-GNMT MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with GNMT purified MaxPab mouse polyclonal antibody (B01P) (H00027232-B01P). |
| Applications: | WB-Tr,IP |
| Shipping condition: | Dry Ice |