Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of GPR81 (Human) Recombinant Protein (Q01)
| Brand | Abnova |
| Product type | Proteins |
| Applications | AP,Array,ELISA,WB-Re |
More info about GPR81 (Human) Recombinant Protein (Q01)
| Brand: | Abnova |
| Reference: | H00027198-Q01 |
| Product name: | GPR81 (Human) Recombinant Protein (Q01) |
| Product description: | Human GPR81 partial ORF (NP_115943.1, 247 a.a. - 346 a.a.) recombinant protein with GST tag at N-terminal. |
| Gene id: | 27198 |
| Gene name: | GPR81 |
| Gene alias: | FKSG80|GPR104|TA-GPCR |
| Gene description: | G protein-coupled receptor 81 |
| Genbank accession: | NM_032554.3 |
| Immunogen sequence/protein sequence: | VPSSACDPSVHGALHITLSFTYMNSMLDPLVYYFSSPSFPKFYNKLKICSLKPKQPGHSKTQRPEEMPISNLGRRSCISVANSFQSQSDGQWDPHIVEWH |
| Protein accession: | NP_115943.1 |
| Preparation method: | in vitro wheat germ expression system |
| Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue |
| Quality control testing picture: |  |
| Note: | Best use within three months from the date of receipt of this protein. |
| Tag: | GST |
| Product type: | Proteins |
| Antigen species / target species: | Human |
| Applications: | AP,Array,ELISA,WB-Re |
| Shipping condition: | Dry Ice |