Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of IL17C MaxPab rabbit polyclonal antibody (D01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | IF,WB-Tr,IP |
More info about IL17C MaxPab rabbit polyclonal antibody (D01)
| Brand: | Abnova |
| Reference: | H00027189-D01 |
| Product name: | IL17C MaxPab rabbit polyclonal antibody (D01) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human IL17C protein. |
| Gene id: | 27189 |
| Gene name: | IL17C |
| Gene alias: | CX2|IL-17C|IL-21|MGC126884|MGC138401 |
| Gene description: | interleukin 17C |
| Genbank accession: | NM_013278 |
| Immunogen: | IL17C (NP_037410.1, 1 a.a. ~ 197 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MTLLPGLLFLTWLHTCLAHHDPSLRGHPHSHGTPHCYSAEELPLGQAPPHLLARGAKWGQALPVALVSSLEAASHRGRHERPSATTQCPVLRPEEVLEADTHQRSISPWRYRVDTDEDRYPQKLAFAECLCRGCIDARTGRETAALNSVRLLQSLLVLRRRPCSRDGSGLPTPGAFAFHTEFIHVPVGCTCVLPRSV |
| Protein accession: | NP_037410.1 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoprecipitation of IL17C transfected lysate using anti-IL17C MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with IL17C MaxPab mouse polyclonal antibody (B01) (H00027189-B01). |
| Applications: | IF,WB-Tr,IP |
| Shipping condition: | Dry Ice |