CHIA purified MaxPab rabbit polyclonal antibody (D01P) View larger

CHIA purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CHIA purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesRabbit
ApplicationsWB-Ti,WB-Tr

More info about CHIA purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00027159-D01P
Product name: CHIA purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human CHIA protein.
Gene id: 27159
Gene name: CHIA
Gene alias: 2200003E03Rik|AMCase|CHIT2|DKFZp313J1722|RP5-1125M8.1|TSA1902
Gene description: chitinase, acidic
Genbank accession: NM_021797.2
Immunogen: CHIA (NP_068569.2, 1 a.a. ~ 368 a.a) full-length human protein.
Immunogen sequence/protein sequence: MVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNIKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTAPAQPIEPITAAPSGSGNGSGSSSSGGSSGGSGFCAVRANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNWA
Protein accession: NP_068569.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00027159-D01P-13-15-1.jpg
Application image note: Western Blot analysis of CHIA expression in transfected 293T cell line (H00027159-T01) by CHIA MaxPab polyclonal antibody.

Lane 1: CHIA transfected lysate(40.10 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CHIA purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart