Brand: | Abnova |
Reference: | H00027158-M01 |
Product name: | NDOR1 monoclonal antibody (M01), clone 3A11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NDOR1. |
Clone: | 3A11 |
Isotype: | IgG2a Kappa |
Gene id: | 27158 |
Gene name: | NDOR1 |
Gene alias: | MGC138148|NR1|bA350O14.9 |
Gene description: | NADPH dependent diflavin oxidoreductase 1 |
Genbank accession: | NM_014434 |
Immunogen: | NDOR1 (NP_055249, 498 a.a. ~ 595 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EWQELEKRDCLTLIPAFSREQEQKVYVQHRLRELGSLVWELLDRQGAYFYLAGNAKSMPADVSEALMSIFQEEGGLCSPDAAAYLARLQQTRRFQTET |
Protein accession: | NP_055249 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: |  |
Application image note: | NDOR1 monoclonal antibody (M01), clone 3A11 Western Blot analysis of NDOR1 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | Diflavin Oxidoreductases Activate the Bioreductive Prodrug PR-104A under Hypoxia.Guise CP, Abbattista MR, Tipparaju SR, Lambie NK, Su J, Li D, Wilson WR, Dachs GU, Patterson AV. Mol Pharmacol. 2012 Jan;81(1):31-40. Epub 2011 Oct 7. |