Brand: | Abnova |
Reference: | H00027141-M12 |
Product name: | CIDEB monoclonal antibody (M12), clone 3H4 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant CIDEB. |
Clone: | 3H4 |
Isotype: | IgG2b Kappa |
Gene id: | 27141 |
Gene name: | CIDEB |
Gene alias: | - |
Gene description: | cell death-inducing DFFA-like effector b |
Genbank accession: | BC035970 |
Immunogen: | CIDEB (AAH35970, 1 a.a. ~ 219 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MEYLSALNPSDLLRSVSNISSEFGRRVWTSAPPPQRPFRVCDHKRTIRKGLTAATRQELLAKALETLLLNGVLTLVLEEDGTAVDSEDFFQLLEDDTCLMVLQSGQSWSPTRSGVLSYGLGRERPKHSKDIARFTFDVYKQNPRDLFGSLNVKATFYGLYSMSCDFQGLGPKKVLRELLRWTSTLLQGLGHMLLGISSTLRHAVEGAEQWQQKGRLHSY |
Protein accession: | AAH35970 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |