CIDEB monoclonal antibody (M12), clone 3H4 View larger

CIDEB monoclonal antibody (M12), clone 3H4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CIDEB monoclonal antibody (M12), clone 3H4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about CIDEB monoclonal antibody (M12), clone 3H4

Brand: Abnova
Reference: H00027141-M12
Product name: CIDEB monoclonal antibody (M12), clone 3H4
Product description: Mouse monoclonal antibody raised against a full-length recombinant CIDEB.
Clone: 3H4
Isotype: IgG2b Kappa
Gene id: 27141
Gene name: CIDEB
Gene alias: -
Gene description: cell death-inducing DFFA-like effector b
Genbank accession: BC035970
Immunogen: CIDEB (AAH35970, 1 a.a. ~ 219 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MEYLSALNPSDLLRSVSNISSEFGRRVWTSAPPPQRPFRVCDHKRTIRKGLTAATRQELLAKALETLLLNGVLTLVLEEDGTAVDSEDFFQLLEDDTCLMVLQSGQSWSPTRSGVLSYGLGRERPKHSKDIARFTFDVYKQNPRDLFGSLNVKATFYGLYSMSCDFQGLGPKKVLRELLRWTSTLLQGLGHMLLGISSTLRHAVEGAEQWQQKGRLHSY
Protein accession: AAH35970
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy CIDEB monoclonal antibody (M12), clone 3H4 now

Add to cart