CIDEB polyclonal antibody (A01) View larger

CIDEB polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CIDEB polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about CIDEB polyclonal antibody (A01)

Brand: Abnova
Reference: H00027141-A01
Product name: CIDEB polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant CIDEB.
Gene id: 27141
Gene name: CIDEB
Gene alias: -
Gene description: cell death-inducing DFFA-like effector b
Genbank accession: NM_014430
Immunogen: CIDEB (NP_055245, 3 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: YLSALNPSDLLRSVSNISSEFGRRVWTSAPPPQRPFRVCDHKRTIRKGLTAATRQELLAKALETLLLNGVLTLVLEEDGTAVDSEDFFQLLEDDTCLMVLQSGQSWSP
Protein accession: NP_055245
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00027141-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.99 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CIDEB polyclonal antibody (A01) now

Add to cart