Brand: | Abnova |
Reference: | H00027136-M09 |
Product name: | MORC1 monoclonal antibody (M09), clone 3E8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MORC1. |
Clone: | 3E8 |
Isotype: | IgG1 Kappa |
Gene id: | 27136 |
Gene name: | MORC1 |
Gene alias: | MORC|ZCW6 |
Gene description: | MORC family CW-type zinc finger 1 |
Genbank accession: | NM_014429 |
Immunogen: | MORC1 (NP_055244, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MDDRYPALQRAQLRLDFIHANSTTHSFLFGALAELLDNARDAGAERLDVFSVDNEKLQGGFMLCFLDDGCGMSPEEASDIIYFGRSKKRLSTLKFIGQYG |
Protein accession: | NP_055244 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | MORC1 monoclonal antibody (M09), clone 3E8. Western Blot analysis of MORC1 expression in HepG2(Cat # L019V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |