MORC1 monoclonal antibody (M09), clone 3E8 View larger

MORC1 monoclonal antibody (M09), clone 3E8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MORC1 monoclonal antibody (M09), clone 3E8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about MORC1 monoclonal antibody (M09), clone 3E8

Brand: Abnova
Reference: H00027136-M09
Product name: MORC1 monoclonal antibody (M09), clone 3E8
Product description: Mouse monoclonal antibody raised against a partial recombinant MORC1.
Clone: 3E8
Isotype: IgG1 Kappa
Gene id: 27136
Gene name: MORC1
Gene alias: MORC|ZCW6
Gene description: MORC family CW-type zinc finger 1
Genbank accession: NM_014429
Immunogen: MORC1 (NP_055244, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MDDRYPALQRAQLRLDFIHANSTTHSFLFGALAELLDNARDAGAERLDVFSVDNEKLQGGFMLCFLDDGCGMSPEEASDIIYFGRSKKRLSTLKFIGQYG
Protein accession: NP_055244
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00027136-M09-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00027136-M09-1-12-1.jpg
Application image note: MORC1 monoclonal antibody (M09), clone 3E8. Western Blot analysis of MORC1 expression in HepG2(Cat # L019V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MORC1 monoclonal antibody (M09), clone 3E8 now

Add to cart