SMC1L2 monoclonal antibody (M01), clone 6A10 View larger

SMC1L2 monoclonal antibody (M01), clone 6A10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SMC1L2 monoclonal antibody (M01), clone 6A10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA,WB-Re

More info about SMC1L2 monoclonal antibody (M01), clone 6A10

Brand: Abnova
Reference: H00027127-M01
Product name: SMC1L2 monoclonal antibody (M01), clone 6A10
Product description: Mouse monoclonal antibody raised against a partial recombinant SMC1L2.
Clone: 6A10
Isotype: IgG1 Kappa
Gene id: 27127
Gene name: SMC1B
Gene alias: FLJ43748|SMC1BETA|SMC1L2|bK268H5|bK268H5.5
Gene description: structural maintenance of chromosomes 1B
Genbank accession: NM_148674
Immunogen: SMC1L2 (NP_683515, 551 a.a. ~ 660 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KVAKDCIRFLKEERAEPETFLALDYLDIKPINERLRELKGCKMVIDVIKTQFPQLKKVIQFVCGNGLVCETMEEARHIALSGPERQKTVALDGTLFLKSGVISGGSSDLK
Protein accession: NP_683515
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00027127-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00027127-M01-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to SMC1B on HeLa cell . [antibody concentration 10 ug/ml]
Applications: IF,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SMC1L2 monoclonal antibody (M01), clone 6A10 now

Add to cart