Brand: | Abnova |
Reference: | H00027125-M01 |
Product name: | AFF4 monoclonal antibody (M01), clone 2E12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant AFF4. |
Clone: | 2E12 |
Isotype: | IgG1 Kappa |
Gene id: | 27125 |
Gene name: | AFF4 |
Gene alias: | AF5Q31|MCEF|MGC75036 |
Gene description: | AF4/FMR2 family, member 4 |
Genbank accession: | NM_014423 |
Immunogen: | AFF4 (NP_055238, 1 a.a. ~ 108 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MNREDRNVLRMKERERRNQEIQQGEDAFPPSSPLFAEPYKVTSKEDKLSSRIQSMLGNYDEMKDFIGDRSIPKLVAIPKPTVPPSADEKSNPNFFEQRHGGSHQSSKW |
Protein accession: | NP_055238 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.62 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to AFF4 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 1 ug/ml] |
Applications: | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |