DKK4 purified MaxPab rabbit polyclonal antibody (D01P) View larger

DKK4 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DKK4 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about DKK4 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00027121-D01P
Product name: DKK4 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human DKK4 protein.
Gene id: 27121
Gene name: DKK4
Gene alias: DKK-4|MGC129562|MGC129563
Gene description: dickkopf homolog 4 (Xenopus laevis)
Genbank accession: NM_014420
Immunogen: DKK4 (NP_055235.1, 1 a.a. ~ 224 a.a) full-length human protein.
Immunogen sequence/protein sequence: MVAAVLLGLSWLCSPLGALVLDFNNIRSSADLHGARKGSQCLSDTDCNTRKFCLQPRDEKPFCATCRGLRRRCQRDAMCCPGTLCVNDVCTTMEDATPILERQLDEQDGTHAEGTTGHPVQENQPKRKPSIKKSQGRKGQEGESCLRTFDCGPGLCCARHFWTKICKPVLLEGQVCSRRGHKDTAQAPEIFQRCDCGPGLLCRSQLTSNRQHARLRVCQKIEKL
Protein accession: NP_055235.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00027121-D01P-13-15-1.jpg
Application image note: Western Blot analysis of DKK4 expression in transfected 293T cell line (H00027121-T02) by DKK4 MaxPab polyclonal antibody.

Lane 1: DKK4 transfected lysate(24.90 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy DKK4 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart