SDCBP2 monoclonal antibody (M01A), clone 3E8 View larger

SDCBP2 monoclonal antibody (M01A), clone 3E8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SDCBP2 monoclonal antibody (M01A), clone 3E8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about SDCBP2 monoclonal antibody (M01A), clone 3E8

Brand: Abnova
Reference: H00027111-M01A
Product name: SDCBP2 monoclonal antibody (M01A), clone 3E8
Product description: Mouse monoclonal antibody raised against a full-length recombinant SDCBP2.
Clone: 3E8
Isotype: IgG2b Kappa
Gene id: 27111
Gene name: SDCBP2
Gene alias: FLJ12256|SITAC18|ST-2
Gene description: syndecan binding protein (syntenin) 2
Genbank accession: BC002727
Immunogen: SDCBP2 (AAH02727, 1 a.a. ~ 292 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSSLYPSLEDLKVDQAIQAQVRASPKMPALPVQATAISPPPVLYPNLAELENYMGLSLSSQEVQESLLQIPEGDSTAVSGPGPGQMVAPVTGYSLGVRRAEIKPGVREIHLCKDERGKTGLRLRKVDQGLFVQLVQANTPASLVGLRFGDQLLQIDGRDCAGWSSHKAHQVVKKASGDKIVVVVRDRPFQRTVTMHKDSMGHVGFVIKKGKIVSLVKGSSAARNGLLTNHYVCEVDGQNVIGLKDKKIMEILATAGNVVTLTIIPSVIYEHMVKKLPPVLLHHTMDHSIPDA
Protein accession: AAH02727
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00027111-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (57.86 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SDCBP2 monoclonal antibody (M01A), clone 3E8 now

Add to cart