Brand: | Abnova |
Reference: | H00027111-M01A |
Product name: | SDCBP2 monoclonal antibody (M01A), clone 3E8 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant SDCBP2. |
Clone: | 3E8 |
Isotype: | IgG2b Kappa |
Gene id: | 27111 |
Gene name: | SDCBP2 |
Gene alias: | FLJ12256|SITAC18|ST-2 |
Gene description: | syndecan binding protein (syntenin) 2 |
Genbank accession: | BC002727 |
Immunogen: | SDCBP2 (AAH02727, 1 a.a. ~ 292 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSSLYPSLEDLKVDQAIQAQVRASPKMPALPVQATAISPPPVLYPNLAELENYMGLSLSSQEVQESLLQIPEGDSTAVSGPGPGQMVAPVTGYSLGVRRAEIKPGVREIHLCKDERGKTGLRLRKVDQGLFVQLVQANTPASLVGLRFGDQLLQIDGRDCAGWSSHKAHQVVKKASGDKIVVVVRDRPFQRTVTMHKDSMGHVGFVIKKGKIVSLVKGSSAARNGLLTNHYVCEVDGQNVIGLKDKKIMEILATAGNVVTLTIIPSVIYEHMVKKLPPVLLHHTMDHSIPDA |
Protein accession: | AAH02727 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (57.86 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |