Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TAF5L monoclonal antibody (M01), clone 1C5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
More info about TAF5L monoclonal antibody (M01), clone 1C5
| Brand: | Abnova |
| Reference: | H00027097-M01 |
| Product name: | TAF5L monoclonal antibody (M01), clone 1C5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TAF5L. |
| Clone: | 1C5 |
| Isotype: | IgG2b Kappa |
| Gene id: | 27097 |
| Gene name: | TAF5L |
| Gene alias: | PAF65B |
| Gene description: | TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa |
| Genbank accession: | NM_014409 |
| Immunogen: | TAF5L (NP_055224, 1 a.a. ~ 117 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MKRVRTEQIQMAVSCYLKRRQYVDSDGPLKQGLRLSQTAEEMAANLTVQSESGCANIVSAAPCQAEPQQYEVQFGRLRNFLTDSDSQHSHEVMPLLYPLFVYLHLNLVQNSPKSTVE |
| Protein accession: | NP_055224 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.61 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of TAF5L expression in transfected 293T cell line by TAF5L monoclonal antibody (M01), clone 1C5. Lane 1: TAF5L transfected lysate(36.99 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |