TAF5L purified MaxPab mouse polyclonal antibody (B01P) View larger

TAF5L purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TAF5L purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,WB-Tr

More info about TAF5L purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00027097-B01P
Product name: TAF5L purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human TAF5L protein.
Gene id: 27097
Gene name: TAF5L
Gene alias: PAF65B
Gene description: TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa
Genbank accession: NM_001025247.1
Immunogen: TAF5L (NP_001020418.1, 1 a.a. ~ 325 a.a) full-length human protein.
Immunogen sequence/protein sequence: MKRVRTEQIQMAVSCYLKRRQYVDSDGPLKQGLRLSQTAEEMAANLTVQSESGCANIVSAAPCQAEPQQYEVQFGRLRNFLTDSDSQHSHEVMPLLYPLFVYLHLNLVQNSPKSTVESFYSRFHGMFLQNASQKDVIEQLQTTQTIQDILSNFKLRAFLDNKYVVRLQEDSYNYLIRYLQSDNNTALCKVLTLHIHLDVQPAKRTDYQLYASGSSSRSENNGLEPPDMPSPILQNEAALEVLQESIKRVKDGPPSLTTICFYAFYNTEQLLNTAEISPDSKLLAAGFDNSCIKLWSLRSKKLKSEPHQVDVSRIHLACDILEEEV
Protein accession: NP_001020418.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00027097-B01P-13-15-1.jpg
Application image note: Western Blot analysis of TAF5L expression in transfected 293T cell line (H00027097-T01) by TAF5L MaxPab polyclonal antibody.

Lane 1: TAF5L transfected lysate(35.75 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TAF5L purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart