View larger

TRAPPC3 purified MaxPab mouse polyclonal antibody (B01P)

Reference:

Condition: New product

Data sheet of TRAPPC3 purified MaxPab mouse polyclonal antibody (B01P)

Brand:	Abnova
Reference:	H00027095-B01P
Product name:	TRAPPC3 purified MaxPab mouse polyclonal antibody (B01P)
Product description:	Mouse polyclonal antibody raised against a full-length human TRAPPC3 protein.
Gene id:	27095
Gene name:	TRAPPC3
Gene alias:	BET3
Gene description:	trafficking protein particle complex 3
Genbank accession:	NM_014408
Immunogen:	TRAPPC3 (NP_055223.1, 1 a.a. ~ 180 a.a) full-length human protein.
Immunogen sequence/protein sequence:	MSRQANRGTESKKMSSELFTLTYGALVTQLCKDYENDEDVNKQLDKMGFNIGVRLIEDFLARSNVGRCHDFRETADVIAKVAFKMYLGITPSITNWSPAGDEFSLILENNPLVDFVELPDNHSSLIYSNLLCGVLRGALEMVQMAVEAKFVQDTLKGDGVTEIRMRFIRRIEDNLPAGEE
Protein accession:	NP_055223.1
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody reactive against mammalian transfected lysate.
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Western Blot analysis of TRAPPC3 expression in transfected 293T cell line (H00027095-T02) by TRAPPC3 MaxPab polyclonal antibody. Lane 1: TRAPPC3 transfected lysate(19.8 KDa). Lane 2: Non-transfected lysate.
Applications:	WB-Tr
Shipping condition:	Dry Ice