KCNMB3 monoclonal antibody (M02), clone 5H1 View larger

KCNMB3 monoclonal antibody (M02), clone 5H1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KCNMB3 monoclonal antibody (M02), clone 5H1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about KCNMB3 monoclonal antibody (M02), clone 5H1

Brand: Abnova
Reference: H00027094-M02
Product name: KCNMB3 monoclonal antibody (M02), clone 5H1
Product description: Mouse monoclonal antibody raised against a partial recombinant KCNMB3.
Clone: 5H1
Isotype: IgG2a Kappa
Gene id: 27094
Gene name: KCNMB3
Gene alias: KCNMB2|KCNMBL
Gene description: potassium large conductance calcium-activated channel, subfamily M beta member 3
Genbank accession: NM_171828
Immunogen: KCNMB3 (NP_741979, 82 a.a. ~ 181 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: FMLSIQREESTCTAIHTDIMDDWLDCAFTCGVHCHGQGKYPCLQVFVNLSHPGQKALLHYNEEAVQINPKCFYTPKCHQDRNDLLNSALDIKEFFDHKNG
Protein accession: NP_741979
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00027094-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00027094-M02-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged KCNMB3 is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy KCNMB3 monoclonal antibody (M02), clone 5H1 now

Add to cart