PELP1 monoclonal antibody (M01), clone 1F7 View larger

PELP1 monoclonal antibody (M01), clone 1F7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PELP1 monoclonal antibody (M01), clone 1F7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA

More info about PELP1 monoclonal antibody (M01), clone 1F7

Brand: Abnova
Reference: H00027043-M01
Product name: PELP1 monoclonal antibody (M01), clone 1F7
Product description: Mouse monoclonal antibody raised against a partial recombinant PELP1.
Clone: 1F7
Isotype: IgG2b Kappa
Gene id: 27043
Gene name: PELP1
Gene alias: HMX3|MNAR|P160
Gene description: proline, glutamate and leucine rich protein 1
Genbank accession: AY882602
Immunogen: PELP1 (AAW80659.1, 337 a.a. ~ 410 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LNSWSIGRDSLSPGQERPYSTVRTKVYAILELWVQVCGASAGMLQGGASGEALLTHLLSDISPPADALKLRSPR
Protein accession: AAW80659.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00027043-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged PELP1 is 0.1 ng/ml as a capture antibody.
Applications: WB-Ce,S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy PELP1 monoclonal antibody (M01), clone 1F7 now

Add to cart