Brand: | Abnova |
Reference: | H00027040-M01 |
Product name: | LAT monoclonal antibody (M01), clone 3B11-1D5 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant LAT. |
Clone: | 3B11-1D5 |
Isotype: | IgG1 kappa |
Gene id: | 27040 |
Gene name: | LAT |
Gene alias: | LAT1|pp36 |
Gene description: | linker for activation of T cells |
Genbank accession: | BC011563 |
Immunogen: | LAT (AAH11563, 1 a.a. ~ 233 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MEEAILVPCVLGLLLLPILAMLMALCVHCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGPHRTPSSRRDSDGANSVASYENEEPACEDADEDEDDYHNPGYLVVLPDSTPATSTAAPSAPALSTPGIRDSAFSMESIDDYVNVPESGESAEASLDGSREYVNVSQELHPGAAKTEPAALSSQEAEEVEEEGAPDYENLQELN |
Protein accession: | AAH11563 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (51.37 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to LAT on formalin-fixed paraffin-embedded human tonsil tissue. [antibody concentration 5 ug/ml] |
Applications: | IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |