LAT monoclonal antibody (M01), clone 3B11-1D5 View larger

LAT monoclonal antibody (M01), clone 3B11-1D5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LAT monoclonal antibody (M01), clone 3B11-1D5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,S-ELISA,ELISA,WB-Re

More info about LAT monoclonal antibody (M01), clone 3B11-1D5

Brand: Abnova
Reference: H00027040-M01
Product name: LAT monoclonal antibody (M01), clone 3B11-1D5
Product description: Mouse monoclonal antibody raised against a full length recombinant LAT.
Clone: 3B11-1D5
Isotype: IgG1 kappa
Gene id: 27040
Gene name: LAT
Gene alias: LAT1|pp36
Gene description: linker for activation of T cells
Genbank accession: BC011563
Immunogen: LAT (AAH11563, 1 a.a. ~ 233 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MEEAILVPCVLGLLLLPILAMLMALCVHCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGPHRTPSSRRDSDGANSVASYENEEPACEDADEDEDDYHNPGYLVVLPDSTPATSTAAPSAPALSTPGIRDSAFSMESIDDYVNVPESGESAEASLDGSREYVNVSQELHPGAAKTEPAALSSQEAEEVEEEGAPDYENLQELN
Protein accession: AAH11563
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00027040-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (51.37 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00027040-M01-3-5-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to LAT on formalin-fixed paraffin-embedded human tonsil tissue. [antibody concentration 5 ug/ml]
Applications: IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy LAT monoclonal antibody (M01), clone 3B11-1D5 now

Add to cart