ACAD8 purified MaxPab mouse polyclonal antibody (B01P) View larger

ACAD8 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ACAD8 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about ACAD8 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00027034-B01P
Product name: ACAD8 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human ACAD8 protein.
Gene id: 27034
Gene name: ACAD8
Gene alias: ACAD-8|FLJ22590
Gene description: acyl-Coenzyme A dehydrogenase family, member 8
Genbank accession: BC001964.1
Immunogen: ACAD8 (AAH01964.1, 1 a.a. ~ 415 a.a) full-length human protein.
Immunogen sequence/protein sequence: MLWSGCRRFGARLGCLPGGLRVLVQTGHRSLTSCIDPSMGLNEEQKEFQKVAFDFAAREMAPNMAEWDQKELFPVDVMRKAAQLGFGGVYIQTDVGGSGLSRLDTSVIFEALATGCTSTTAYISIHNMCAWMIDSFGNEEQRHKFCPPLCTMEKFASYCLTEPGSGSDAASLLTSAKKQGDHYILNGSKAFISGAGESDIYVVMCRTGGLGPKGISCIVVEKGTPGLSFGKKEKKVGWNSQPTRAVIFEDCAVPVANRIGSEGQGFLIAVRGLNGGRINIASCSLGAAHASVILTRDHLNVRKQFGEPLASNQYLQFTLADMATRLVAARLMVRNAAVALQEERKDAVALCSMAKLFATDECFAICNQALQMHGGYGYLKDYAVQQYVRDSRVHQILEGSNEVMRILISRSLLQE
Protein accession: AAH01964.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00027034-B01P-13-15-1.jpg
Application image note: Western Blot analysis of ACAD8 expression in transfected 293T cell line (H00027034-T01) by ACAD8 MaxPab polyclonal antibody.

Lane 1: ACAD8 transfected lysate(45.65 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ACAD8 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart