ZBTB32 purified MaxPab mouse polyclonal antibody (B01P) View larger

ZBTB32 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZBTB32 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,WB-Tr

More info about ZBTB32 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00027033-B01P
Product name: ZBTB32 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human ZBTB32 protein.
Gene id: 27033
Gene name: ZBTB32
Gene alias: FAXF|FAZF|Rog|TZFP|ZNF538
Gene description: zinc finger and BTB domain containing 32
Genbank accession: BC017700
Immunogen: ZBTB32 (AAH17700, 1 a.a. ~ 302 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSLPPIRLPSPYGSDRLVQLAARLRPALCDTLITVGSQEFPAHSLVLAGVSQQLGRRGQWALGEGISPSTFAQLLNFVYGESVELQPGELRPLQEAARALGVQSLEEACWRARGDRAKKPDPGLKKHQEEPEKPSRNPERELGDPGEKQKPKQVSRTGGREQEMLHKHSPPRGRPEMAGATQEAQQEQTRSKEKRLQAPVGQRGADGKHGVLTWLRENPGGSEESLRKLPGPLPPAGSLQTSVTPRPSWAEAPWLVGGQPALWSILLMPPRYGIPFYHSTPTTGAWQEVWREQRRTCNLCGS
Protein accession: AAH17700
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00027033-B01P-13-15-1.jpg
Application image note: Western Blot analysis of ZBTB32 expression in transfected 293T cell line (H00027033-T01) by ZBTB32 MaxPab polyclonal antibody.

Lane 1: ZBTB32 transfected lysate(33.33 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ZBTB32 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart