ZBTB32 MaxPab mouse polyclonal antibody (B01) View larger

ZBTB32 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZBTB32 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,WB-Tr

More info about ZBTB32 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00027033-B01
Product name: ZBTB32 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human ZBTB32 protein.
Gene id: 27033
Gene name: ZBTB32
Gene alias: FAXF|FAZF|Rog|TZFP|ZNF538
Gene description: zinc finger and BTB domain containing 32
Genbank accession: BC017700
Immunogen: ZBTB32 (AAH17700, 1 a.a. ~ 302 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSLPPIRLPSPYGSDRLVQLAARLRPALCDTLITVGSQEFPAHSLVLAGVSQQLGRRGQWALGEGISPSTFAQLLNFVYGESVELQPGELRPLQEAARALGVQSLEEACWRARGDRAKKPDPGLKKHQEEPEKPSRNPERELGDPGEKQKPKQVSRTGGREQEMLHKHSPPRGRPEMAGATQEAQQEQTRSKEKRLQAPVGQRGADGKHGVLTWLRENPGGSEESLRKLPGPLPPAGSLQTSVTPRPSWAEAPWLVGGQPALWSILLMPPRYGIPFYHSTPTTGAWQEVWREQRRTCNLCGS
Protein accession: AAH17700
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00027033-B01-13-15-1.jpg
Application image note: Western Blot analysis of ZBTB32 expression in transfected 293T cell line (H00027033-T01) by ZBTB32 MaxPab polyclonal antibody.

Lane 1: ZBTB32 transfected lysate(33.33 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ZBTB32 MaxPab mouse polyclonal antibody (B01) now

Add to cart