ATP2C1 monoclonal antibody (M01), clone 2G1 View larger

ATP2C1 monoclonal antibody (M01), clone 2G1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ATP2C1 monoclonal antibody (M01), clone 2G1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP,RNAi-Ab

More info about ATP2C1 monoclonal antibody (M01), clone 2G1

Brand: Abnova
Reference: H00027032-M01
Product name: ATP2C1 monoclonal antibody (M01), clone 2G1
Product description: Mouse monoclonal antibody raised against a partial recombinant ATP2C1.
Clone: 2G1
Isotype: IgG1 lambda
Gene id: 27032
Gene name: ATP2C1
Gene alias: ATP2C1A|BCPM|HHD|KIAA1347|PMR1|SPCA1|hSPCA1
Gene description: ATPase, Ca++ transporting, type 2C, member 1
Genbank accession: BC028139
Immunogen: ATP2C1 (AAH28139, 119 a.a. ~ 269 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VQEYRSEKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSIDESSLTGETTPCSKVTAPQPAATNGDLASRSNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQL
Protein accession: AAH28139
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00027032-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (42.35 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00027032-M01-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to ATP2C1 on HeLa cell. [antibody concentration 10 ug/ml]
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP,RNAi-Ab
Shipping condition: Dry Ice
Publications: Golgi calcium pump secretory pathway calcium ATPase 1 (SPCA1) is a key regulator of insulin-like growth factor receptor (IGF1R) processing in the basal-like breast cancer cell line MDA-MB-231.Grice DM, Vetter I, Faddy HM, Kenny PA, Roberts-Thomson SJ, Monteith GR.
J Biol Chem. 2010 Nov 26;285(48):37458-66. Epub 2010 Sep 13.

Reviews

Buy ATP2C1 monoclonal antibody (M01), clone 2G1 now

Add to cart