Brand: | Abnova |
Reference: | H00027032-M01 |
Product name: | ATP2C1 monoclonal antibody (M01), clone 2G1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ATP2C1. |
Clone: | 2G1 |
Isotype: | IgG1 lambda |
Gene id: | 27032 |
Gene name: | ATP2C1 |
Gene alias: | ATP2C1A|BCPM|HHD|KIAA1347|PMR1|SPCA1|hSPCA1 |
Gene description: | ATPase, Ca++ transporting, type 2C, member 1 |
Genbank accession: | BC028139 |
Immunogen: | ATP2C1 (AAH28139, 119 a.a. ~ 269 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VQEYRSEKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSIDESSLTGETTPCSKVTAPQPAATNGDLASRSNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQL |
Protein accession: | AAH28139 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (42.35 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to ATP2C1 on HeLa cell. [antibody concentration 10 ug/ml] |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP,RNAi-Ab |
Shipping condition: | Dry Ice |
Publications: | Golgi calcium pump secretory pathway calcium ATPase 1 (SPCA1) is a key regulator of insulin-like growth factor receptor (IGF1R) processing in the basal-like breast cancer cell line MDA-MB-231.Grice DM, Vetter I, Faddy HM, Kenny PA, Roberts-Thomson SJ, Monteith GR. J Biol Chem. 2010 Nov 26;285(48):37458-66. Epub 2010 Sep 13. |