Brand: | Abnova |
Reference: | H00027031-M05 |
Product name: | NPHP3 monoclonal antibody (M05), clone 3B1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NPHP3. |
Clone: | 3B1 |
Isotype: | IgG1 Kappa |
Gene id: | 27031 |
Gene name: | NPHP3 |
Gene alias: | DKFZp667K242|DKFZp781K1312|FLJ30691|FLJ36696|KIAA2000|MGC78666|NPH3 |
Gene description: | nephronophthisis 3 (adolescent) |
Genbank accession: | NM_153240 |
Immunogen: | NPHP3 (NP_694972.3, 106 a.a. ~ 205 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | NQELLSMGRREAKLDTENKRLRAELQALQKTYQKILREKESALEAKYQAMERAATFEHDRDKVKRQFKIFRETKENEIQDLLRAKRELESKLQRLQAQGI |
Protein accession: | NP_694972.3 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | NPHP3 monoclonal antibody (M05), clone 3B1. Western Blot analysis of NPHP3 expression in HepG2. |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |