NPHP3 monoclonal antibody (M05), clone 3B1 View larger

NPHP3 monoclonal antibody (M05), clone 3B1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NPHP3 monoclonal antibody (M05), clone 3B1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about NPHP3 monoclonal antibody (M05), clone 3B1

Brand: Abnova
Reference: H00027031-M05
Product name: NPHP3 monoclonal antibody (M05), clone 3B1
Product description: Mouse monoclonal antibody raised against a partial recombinant NPHP3.
Clone: 3B1
Isotype: IgG1 Kappa
Gene id: 27031
Gene name: NPHP3
Gene alias: DKFZp667K242|DKFZp781K1312|FLJ30691|FLJ36696|KIAA2000|MGC78666|NPH3
Gene description: nephronophthisis 3 (adolescent)
Genbank accession: NM_153240
Immunogen: NPHP3 (NP_694972.3, 106 a.a. ~ 205 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: NQELLSMGRREAKLDTENKRLRAELQALQKTYQKILREKESALEAKYQAMERAATFEHDRDKVKRQFKIFRETKENEIQDLLRAKRELESKLQRLQAQGI
Protein accession: NP_694972.3
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00027031-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00027031-M05-1-12-1.jpg
Application image note: NPHP3 monoclonal antibody (M05), clone 3B1. Western Blot analysis of NPHP3 expression in HepG2.
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy NPHP3 monoclonal antibody (M05), clone 3B1 now

Add to cart