NGFRAP1 monoclonal antibody (M01), clone 4E5 View larger

NGFRAP1 monoclonal antibody (M01), clone 4E5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NGFRAP1 monoclonal antibody (M01), clone 4E5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about NGFRAP1 monoclonal antibody (M01), clone 4E5

Brand: Abnova
Reference: H00027018-M01
Product name: NGFRAP1 monoclonal antibody (M01), clone 4E5
Product description: Mouse monoclonal antibody raised against a partial recombinant NGFRAP1.
Clone: 4E5
Isotype: IgG2b Kappa
Gene id: 27018
Gene name: NGFRAP1
Gene alias: BEX3|Bex|DXS6984E|HGR74|NADE
Gene description: nerve growth factor receptor (TNFRSF16) associated protein 1
Genbank accession: BC003190
Immunogen: NGFRAP1 (AAH03190, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MANIHQENEEMEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGMGGDGDDMEIFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEFCLM
Protein accession: AAH03190
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00027018-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00027018-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged NGFRAP1 is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy NGFRAP1 monoclonal antibody (M01), clone 4E5 now

Add to cart