Cart 128 Product Products 54 240,06 € (empty)
No products
To be determined Shipping
54 240,06 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 128 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 54 240,06 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 54 240,06 €
Data sheet of NGFRAP1 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,WB-Tr |
More info about NGFRAP1 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00027018-B01P |
| Product name: | NGFRAP1 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human NGFRAP1 protein. |
| Gene id: | 27018 |
| Gene name: | NGFRAP1 |
| Gene alias: | BEX3|Bex|DXS6984E|HGR74|NADE |
| Gene description: | nerve growth factor receptor (TNFRSF16) associated protein 1 |
| Genbank accession: | NM_206917 |
| Immunogen: | NGFRAP1 (NP_996800.1, 1 a.a. ~ 101 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGMGGDGDDMEIFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEFCLMP |
| Protein accession: | NP_996800.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of purified MaxPab antibody to NGFRAP1 on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | IF,WB-Tr |
| Shipping condition: | Dry Ice |