USP21 monoclonal antibody (M03), clone 3D10 View larger

USP21 monoclonal antibody (M03), clone 3D10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of USP21 monoclonal antibody (M03), clone 3D10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about USP21 monoclonal antibody (M03), clone 3D10

Brand: Abnova
Reference: H00027005-M03
Product name: USP21 monoclonal antibody (M03), clone 3D10
Product description: Mouse monoclonal antibody raised against a partial recombinant USP21.
Clone: 3D10
Isotype: IgG2a Kappa
Gene id: 27005
Gene name: USP21
Gene alias: MGC3394|USP16|USP23
Gene description: ubiquitin specific peptidase 21
Genbank accession: NM_012475
Immunogen: USP21 (NP_036607, 466 a.a. ~ 565 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: FSASRGSIKKSSVGVDFPLQRLSLGDFASDKAGSPVYQLYALCNHSGSVHYGHYTALCRCQTGWHVYNDSRVSPVSENQVASSEGYVLFYQLMQEPPRCL
Protein accession: NP_036607
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00027005-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00027005-M03-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged USP21 is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy USP21 monoclonal antibody (M03), clone 3D10 now

Add to cart